[Arg6]-β-Amyloid (1-40), england mutation_product_DataBase

CAS: 1802084-26-9 F: C194H300N54O58S W: 4348.85

-β-Amyloid (1-40), england mutation is a biological active peptide. (Several mutations in the beta amyloid precursor ge

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	[Arg6]-β-Amyloid (1-40), england mutation is a biological active peptide. (Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the English mutation, with His at position 6 replaced with Arg, was reported to accelerate the kinetics of oligomers formation which act as fibril seeds and are more toxic to cultured neuronal cells.)
Name	[Arg6]-β-Amyloid (1-40), england mutation
CAS	1802084-26-9
Sequence	Asp-Ala-Glu-Phe-Arg-Arg-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Shortening	DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Formula	C194H300N54O58S
Molar Mass	4348.85
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.

PeptideDB